GenomeNet

>pti:PHATRDRAFT_51136 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (RefSeq) PEPCase_2; hypothetical protein (A)
MIDAASKLTATEALGVTRVFSIMLNLVNAAEVQHRNRQIRAHESTKDPSGGPLPKTEDSI
RGTMETLLESKQATPEEIFAQLQKQKVEIVLTAHPTQVQRKSLLRKYRRVSEMLAYLERP
DLDGFEKSSAQTSLQTILSSIWGADEIRRQKPTPQQEAAGGNAILESVLWDAVPAYLRKL
DQQCRLTLGQSLPVDVCPIKFASWIGGDRDGNPNVTPEVTREVVLQQRLRAARLLLKDMY
DLISELAISSRFSPAMDALADSVKDSQHKREKYRRVIGHLIKRLVKTARECELELSKLNT
SASMVSQTLVEEAVDGWQDVDALDDATDLIKPLRIMYDSLVETGFGLVADGLLVDIIRRL
YVFGMSLVPLDIREESTKHTEALDAITRWLGIGSYSEWTEEARLSWLTSELSNKRPLYRI
RELPKLGFNDSVLKTLNVFGTIATLRPSCLGAYVISQAQTASDVLAVMLLQKQYGMTDKN
RNMMRVVPLFETLNDLTNAPDKLEQLFSIPLYVGAVKGKQEVMVGYSDSAKDAGRLAACW
AQYNSQERMVKVAAKHNIELTFFHGKGGTVGRGGNPSVYRAIMSHPPNTINGRFRVTEQG
EMITQNFGAPSIAERTLDIYTAGVCREAFSERVEPSQAWRDQMQRISDVSCAEYRHLVRE
EPRFVPYFRQATPELELGSLNIGSRPAKRNPKGGIESLRAIPWTFAWTQTRTHLSAWLGV
GAGLTTTDQSELKTLRAMYIEWPWFRETIDLIAMIVSKTDFSISKNYDDQLVEKKEGLLK
LGDEVREKMVQTRQAVLDVTESTDVAGAHVALMRGSSTIRHPYVDPVNVIQAELLKRLRV
MDKKKSLLADEMEEQEILKDALIISINGIAQGMRNSG

BLAST