GenomeNet

>ptm:GSPATT00009194001 hypothetical protein; K00031 isocitrate dehydrogenase [EC:1.1.1.42] (A)
MSGPVFKAAAKWTGRKINVKNTVVELDGDEQARIIWKMIRERLVLPYLNVNLEYYDLSME
HRDKTDDKVTFDSGYAILKHKVGVKCATITADEARVEEFKLKKMWPSPNGSIRAILDGTV
FREPIICKNIPRLVPGWTQPIVIGRHSYGDQYKCQDVKLPGPGKLELIYTPTQGEQVKRT
IFEFKGKGGVGLGMYNTYESIVNFAHQSFQYALMRKYPLMLGTKNTILKQYDGYFKDIFQ
EIFETKYKKDFDANKLWYEHRLIDDLVAQMMKSSGGFVLALKNYDGDVQSDIVAQGYGSL
GMMTSELVANDGVYESEAAHGTITRHYREHQKGKETSTNSVASIYAWTRGLRHRGRLDNN
QELIKFAETIESSIIQTIESGLFTKDLALIVHGPKADRSTYLNTEQFIDAVNGKLQSNLG
FLK

BLAST