GenomeNet

>ptm:GSPATT00011565001 hypothetical protein; K06067 histone deacetylase 1/2 [EC:3.5.1.98] (A)
MIQADSDSSRRVAYFYNRLIGKFHYGKEHPMKPKRIAMAHSLIVNFGQLYRSLDVYLIRE
AQLEELKKFHDPEYVTYLSQYMSDNKVNFVKEYCSTNNDGVIPENLLEEYRLITKWSQNK
NTKNLNAEYKVGDSADNPTFSGLFSYCQFSAGASIDCAHTILTGQADIAINWSGGLHHAK
KKEAAGFCYINDIVLCILELLRIYVRVLYVDIDCHHGDGVEEAFYLTNRVMTLSFHQYGD
DFFPGTGQLNSVGLGVGRYYAVNVPLKPGISDGPYLDLFKKVTSRVMETFRPDCVVVQCG
ADSLSLDRLGALNLSIKGHGQCITYMKQFGVPLILLGGGGYTIQNVSRCWAYETGLCLGQ
NIDEPIPTNDVYYKNYSGDYHLHFPIQEHVENKNKAEDLNKIVSQVYDHLKNLENAPGIH
FHDVPYSFYPNMDLENEDDNKINMDMKQEISLSELEQEIGVSDEANAISVNSGSRKIHSK
EV

BLAST