GenomeNet

>ptm:GSPATT00014047001 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (RefSeq) hypothetical protein (A)
MNKVAFVTVASLLTQRKIQLQSAGDSQQIYYKLKSREEHLADALQSEYDVIIVGGGATGA
GVSLACANRGLKSIVLESQDYASGASSKSTKLVHGGVRYMQQIFQLSEKNRIEKWDLVSE
SLRERSNFLSMCSYLTQDFPTLIPCNNLFDLGYYYLGSLVYHCVYLYYQTGGHTFKPPRI
VGKEEIQSHFKFAKCNYGVIYYDGQFNDARMVQELLVTSSLKGTLNMANYVEVKGLLKDE
QNKITGVQAFDKIGQKQIKIKGKCVVNATGGWADNLRLMDDPTVSKRIVSVAGSHITLPQ
KYGSRHWGYLIPKTSDGRVLYMIPWQGNMIMGTTERKLESPTHDPTVSHEEYMWLLKSFC
DEFTVDASEAARDVKSKWCGVRPLVYQSDALSTKEVSRTHQIEVSKSGLISVMGGKWTIF
RLMGEQAVDKVQQLIGKNQKRIENLPKLVGDWTQFDHRKEIQIMMKMFDLPQSYAAYFLT
TYGDRAYDVLKLIYEKPENKESLHPQFPHTVGEILYQIRYEQARKPEDILFRRTRLGFLD
QNAIFTVYEKVFQIMAKELKWSDKFQQQFLKENFEYIRKLEF

BLAST