GenomeNet

>ptm:GSPATT00022184001 K01841 phosphoenolpyruvate phosphomutase [EC:5.4.2.9] | (RefSeq) hypothetical protein (A)
MFKFLLRPSLLFSKRTTKLKNLIQSKDLEFIMEAHNGLSALIVQEAGFKGIWASGLSMSA
GLGVRDCNEASWTQLLEVLEFMAERTTIPILMDGDTGFGNYNNARRLVRKLEERGIAGVC
FEDKIFPKRNSLGDGAQELANIQEFSNKIKACKDFQRDKDFQIVARCESFIAGWGLENAL
ERCEAYRKAGVDAVLIHSKQSDFTEIESFVKVWNNRLPVVIVPTNYYKTPTEEFRKHNIS
LAIWANHNLRASLKAMQDTSKQIFERQNLIGLDNIASVKEVFRLQNEEGLEKDDKKYL

BLAST