GenomeNet

>ptm:GSPATT00026400001 hypothetical protein; K02358 elongation factor Tu (A)
MLHTLRSIQAPFTLNNTARALFAKFVRDKPHLNVGTIGHIDHGKTTLTSAITKVLAKQQL
AEFQEYGKIDKAPEEKARGITINSATVEYQTKTRHYGHVDCPGHIDYVKNMITGAAKMDA
AILVVAATDGCMAQTREHVLLCRQVGVETIIVFVNKIDLAKDPEIHELVEMEIRELLSKY
EYDGDNAKIVKGSALLASNDQEPELGEKSILQLLETMDKEIKIPQRPIDKPFLMSIEGTY
HIAGRGTVVTGTIDQGKASIKDNIEVVGYGKPKQTAIVGVETFKKQLDFGEAGDNVGILI
RGLTRDDVRRGQVLCKPGSLTTHNCIESNLYILKEEEGGRKKPFPNGYRPQMFVRTADVA
VTLYRYARRYLHCKLNLSYNLPLYQGQRFALREGGKTVAAGVISKILPDEVAPTSKKQIL
DKQEAAEKKQKEADDSKAAAAAKTAAAAAKPAAGAKAAGGAKPAAKAPPKK

BLAST