GenomeNet

>ptm:GSPATT00026400001 K02358 elongation factor Tu | (RefSeq) hypothetical protein (A)
MLHTLRSIQAPFTLNNTARALFAKFVRDKPHLNVGTIGHIDHGKTTLTSAITKVLAKQQL
AEFQEYGKIDKAPEEKARGITINSATVEYQTKTRHYGHVDCPGHIDYVKNMITGAAKMDA
AILVVAATDGCMAQTREHVLLCRQVGVETIIVFVNKIDLAKDPEIHELVEMEIRELLSKY
EYDGDNAKIVKGSALLASNDQEPELGEKSILQLLETMDKEIKIPQRPIDKPFLMSIEGTY
HIAGRGTVVTGTIDQGKASIKDNIEVVGYGKPKQTAIVGVETFKKQLDFGEAGDNVGILI
RGLTRDDVRRGQVLCKPGSLTTHNCIESNLYILKEEEGGRKKPFPNGYRPQMFVRTADVA
VTLYRYARRYLHCKLNLSYNLPLYQGQRFALREGGKTVAAGVISKILPDEVAPTSKKQIL
DKQEAAEKKQKEADDSKAAAAAKTAAAAAKPAAGAKAAGGAKPAAKAPPKK

BLAST