GenomeNet

>ptm:GSPATT00028747001 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (RefSeq) hypothetical protein (A)
MQIFKNSKFFFGTLKAHTLPALKYGYSDLEPVLSATLLEFHHSKHHQAYINNLNAAQEQL
EDALTKNDVQKIATLQGTIKFNLGGHLNHSVVLGELDPNQEWRRTITSWKQCSSLRNQQK
LGKTAAIQGSGWGFLGVDQQSKKLRYLELPNQEIPQNYGLTPILTIDVWEHAYWWDYKNV
RPNFLANVWKIVNWKDVEARYNQAQK

BLAST