GenomeNet

>ptm:GSPATT00034995001 hypothetical protein; K00857 thymidine kinase [EC:2.7.1.21] (A)
MYTGTISVIYGPMFSGKTSELMRLVKRFTISERKCVVLNYANDNRYSGEQCISSHDKQFL
RAIKVCKLNEAYEKCKESDVVAIDEGQFFQDIVEFSEKMANLGKIVIVAALDGTFDRKPF
HNILNLIPLAERITKLTAVCWFCKRENASFTKRIVQSKEIELIGGEDCYKPACRLCFHLA
ESQLKGQPIAQTQFVNQENHYDQNNLIC

BLAST