GenomeNet

>ptm:GSPATT00036320001 hypothetical protein; K11418 histone deacetylase 11 [EC:3.5.1.98] (A)
MQLYTIIDWFFTIGSLVLAILLGVYVNGAACLLGVFLYFIYPFIMEFSYNLLSVREEICI
RNMPEIPIVYDESYNITACGIEKWHPFDSCKYGNVYRQIRQQVKGSHFTPKMLSRGTFLY
LGMSKWYLLKMCYSAYASTLIELPVFFLPGAFLRSCLLDSMLLATSGSIQAAKLALEKGW
AINLSGGYHHASLNRGGGFCIYPDITLVVNYLKRCCNLKKIVIVDLDAHQGNGYERDFLN
DSSVYIIDFYNSYIYPGDHIAEQAISCFEHIDKDTSDQQYIKTLQRDLETHLKDDMEFLI
YNAGTDIMAGDPLGHCCISAAGIKRRDEVVFKWAQHKKIPFLMLLSGGYQKENTFAIGES
ILQLIT

BLAST