GenomeNet

>ptm:GSPATT00037872001 hypothetical protein (A)
MKSTQMTKEQISEEYTLYKRYVQHLQSTLLQDEGQIQREIKVNVIRTEAYEIDIKVKRNR
DNLPIRTNYYKSMPGNIRLQHPTPVLLERLTPLSIPTKLTEDIEEHVQNLEQGLAKSIDD
SKHYLRLEHKLFIDFFFEKFKEKFTSLQVVFQLQQLAQAIGCSADQVQSYYLAKQAKKYD
QFVNFNVKYQFVRFNRYFCPICNLYLCSLHYHSKNQRLYIEKEPEEEPQDQQKDDPTHHD
NFYETEFKPNSLLLREIFGRYKLNNKTEMEQRCRDITQCGKYGVDQTKMKKFQQKSIEQM
LEFGFSNCCFMARVLTHRIYPVTCQQINYLIKTLKSQSKKHMTNGKRKQQQASKKQNLNN
YAQQYIPCFHEGECGSNSCTCVTCHKYCCCKGQCQQKSKSCDCRVCGYDEKKQKHSCPCY
ISGYECDPQLCKCQSCSNKNLLMQIRKSLVLGKSLICNGLGLFAAQNFKVCDFVGEYTGN
YILLDDESMAIEQCDWITNNHYLFEVDDKWQVDGTYYSNCLRYINHATKKSDLANCQAQI
LFSEGRWRIAMFTTKNISIGEELFFDYGDKFLTKWLTDFNKLCDDYYKK

BLAST