GenomeNet

>ptr:449567 ACE, DCP1; angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 (EC:3.4.15.1); K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MGAASGRRGPGLLLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQVLF
QSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPVWQNFTDPQLRRIIG
AVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASSRSY
AMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEH
LYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPFPD
KPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVCHAS
AWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRGGANPGFHEAIGD
VLALSVSTPAHLHKIGLLDNVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGR
TPNSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHE
ALCKEAGYEGPLHQCDIYQSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLLKY
FQPVTQWLQEQNQQNGEVLGWPEYQWHPPLPDNYPEGIDLVTDEAEASKFVEEYDRTSQV
VWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARRFDVNQLQNTTIKRIIK
KVQDLERAALPAQELEEYNKILLDMETTYSVATVCHTNGSCLQLEPDLTNVMATSRKYED
LLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLF
QELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAP
SMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAW
DFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVL
ALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSIT
KENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEAL
CQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFK
PLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQWLL
LFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFDSEVELRHS

BLAST