GenomeNet

>ptr:450504 HKDC1; hexokinase domain containing 1; K00844 hexokinase [EC:2.7.1.1] (A)
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAA
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIR
GNGTELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSHLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGSNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALGDIRTEFDRELDLGSLNPGKQLFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILVDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVERLRTTVGMDGTLYKIH
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDRVLALFQLT
REQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGASLPLGFT
FSFPCRQMSIDKTKVPSQFLLGTGSNMCYMEDMRNIEMVEGGEGKMCINTEWGGFGDNGC
IDDIRTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLR
TRGIFETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAG
LAAIVEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKKLAPRCDVTFMLSEDGS
GKGAALITAVAKRLQQAQKEN

BLAST