GenomeNet

>ptr:462770 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) GSTA3; glutathione S-transferase A3 isoform X1 (A)
MFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLP
LCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEEL
DSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF

BLAST