GenomeNet

>ptr:463875 K09188 histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43] | (RefSeq) KMT2C; histone-lysine N-methyltransferase 2C isoform X20 (A)
MYHYPCAAGAGTFQDFSHIFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCTTCGQ
HYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKS
VPTNGWKCKNCRICIECGTRSSSQWHHNCLICDNCYQQQDNLCPFCGKYYHPELQKDMLH
CNMCKRWVHLECDKPTDHELDTQLKEEYICMYCKHLGAEMDPLQPGEEVEVAELTTDYNN
EMEVEGPEDQMVFSEQAVNKDVNGQESTPGIVPDAVQVHTEEQQKSHPSESLDTDTLLIA
VSSQHTVNTELEKQISNEVDSEDLKMSSEVKHICGEDQIEDKMEVTENIEVVTHQITVQQ
EQLQLLEEPKTVVSREESRPPKLVMESVTLPLETLVSPHEESTSLCPEEQLVIERLQGEK
EQKENSELSTGLMDSEMTPTIEGCVKDVSYQGSKSIKLSSETESSFSSSADISKADASSS
PTPSSDLPSHDMLHNYPSALSSSAGNIMPTTYISVTPKIGMGKPAITKRKFSPGRPRSKQ
GAWSTHNTVSPPSWSPDISEGREIFKPRQLPGSAIWSIKVGRGSGFPGKRRPRGAGLSGR
GGRGRSKLKSGIGAVVLPGVSTADISSNKDDEENSMHNTVVLFSSSDKFTLNQDMCVVCG
SFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATDPGRLLL
CDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAPCASL
SSCPVCYRNYREEDLILQCRQCDRWMHAVCQNLNTEEEVENVADIGFDCSMCRPYMPASN
VPSSDCCESSLVAQIVTKVKELDPPKTYTQDGVCLTESGMTQLQSLTVTVPRRKRSKPKL
KLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGELMDCDGKSESSPEREAVDDETKGV
EGTDGVKKRKRKPYRPGIGGFMVRQRSRTGQGKTKRSVIRKESSGSISEQLPCRDDGWSE
QLPDTLVDESVSVTESTEKIKKRYRKRKNKLEETFPAYLQEAFFGKDLLDTSRQSKISLD
NLSEDGAQLLYKTNMNTGFLDPSLDPLLSSSSAPTKSGTHGPADDPLADISEVLNTDDDI
LGIISDDLAKSVDHSGLDLCTFQVESSPFPFDIGPVTDDPSSLPQPNVNQSSRPLSEEQL
DGILSPELDKMVTDGAILGKLYKIPELGGKDVEDLFTAVLSPANTQPTPLPQPPPPTQLL
PIHNQDVFSRMPLMNGLIGPSPHLPHNSLPPGSGLGTFSAIAQSSYPDARDKNSAFNPMA
SDPNNSWTSSAPTVEGENDTMSNAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEF
PDWTTRVKQIAKLWRKASSQERAPYVQKARDNRAALRINKVQMSNDSMKRQQQQDSIDPS
SRIDSELFKDPLKQRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQQQQQ
FGSQHLLVQSGSDTPSSGIQSPLTPQPGNGNMSPAQSFHKELFTKQPTSTPTSTSSDDVF
VKPQAPPPPPAPSRIPIQDSLSQAQTSQPPSPQVFSPGSSNSRPPSPMDPYAKMVGTPRP
PPVGHSFSRRNSAAPVENCTPLSSVSRPLQMNETTANRPSPVRDLCSSSTTNNDPYAKPP
DTPRPVMTDQFPKSLGLSRSPVVSEQTAKGPVAAGTSDHFTKPSPRADVFQRQRIPDSYA
RPLLTPAPLDSGPGPFKTPMQPPPSSQDPYGSVSQASRRLSVDPYERPALTPRPIDNFSH
NQSNDPYSQPPLTPHPAMNESFAHPSRAFSQPGTISRPTSQDPYSQPPGTPRPVVDSYSQ
SSGTARSNTDPYSQPPGTPRPTTVDPYSQQPQTPRPSTQTDLFVTPVTNQRHSDPYAHPP
GTPRPGISVPYSQPPATPRPRISEGFTRSSMTRPVLMPNQDPFLQAAQNRGPALPGPLVR
PPDTCSQTPRPPGPGLSDTFSRVSPSAARDPYDQSPMTPRSQSDSFGTSQTAHDVADQPR
PGSEGSFCASSNSPMHSQGQQFSGVSQLPGPVPTSGVTDTQNTVNMAQADTEKLRQRQKL
REIILQQQQQKKIAGRQEKGSQDSPAVPHPGPLQHWQPENVNQAFTRPPPPYPGNIRSPV
APPLGPRYAVFPKDQRGPYPPDVASMGMRPHGFRFGFPGGSHGTMPSQERFLVPPQQIQG
SGVSPQLRRSVAVDMPRPLNNSQMNNPVGLPQHFSPQSLPVQQHNILGQAYIELRHRAPD
GRQRLPFSAPPGSVVEASSNLRHGNFIPRPDFPGPRHTDPMRRPPQGLPNQLPVHPDLEQ
VPPSQQEQGHSVHSSSMVMRTLNHPLGGEFSEAPLSTSVPSETTSDNLQITTQPSDGLEE
KLDSDVPSVKELDVKDLEGVEVKDLDDEDLENLNLDTEDGKVVELDTLDNLETNDPNLDD
LLRSGEFDIIAYTDPELDMGDKKSMFNEELDLPIDDKLDNQCVSVEPKKKEQENKTLVLS
DKHSPQKKSTVTNEVKTEVLSPNSKVESKCETEKNDENKDNVDTPCSQASAHSDLNDGEK
TSLHPCDPDLFEKRTNRETAGPGANVIQASTQLPAQDVINSCGITGSTPVLSSLLANEKS
DNSDIRPLGSPPPPTLPASPSNHVSSLPPLIAPPGRVLDNTMNSNVTVVSRVNHVFSQGV
QVNPGFIPGQSTVNHNLGTGKPATQTGPLTSQSGTSGMSGPQQLMIPQTLAQQNRERPLL
LEEQPLLLQDLLDQERQEQQQQRQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMVALKGI
NKVMAQNNLGMPPMVMSRFPFMGQAVTGTQNSEGQNLGPQAIPQDGSITHQISRPNPPNF
GPGFVNDSQRKQYEEWLQETQQLLQMQQKYLEEQIGAHRKSKKALSAKQRTAKKAGREFP
EEDAEQLKHVTEQQSMVQKQLEQIRKQQKEHAELIEDYRIKQQQQCAMAPPTMMPSVQPQ
PPLIPGATPPTMSQPAFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLN
PPRIQPPIAQLPIKTCTPAPGTVSNANPQSGPPPRVEFDDNNPFSESFQERERKERLREQ
QERQRIQLMQEVDRQRALQQRMEMEQHGMVGSEISSSRTSVSQIPFYSSDLPCDFMQPLG
PLQQSPQHQQQMGQVLQQQNIQQGSINSPSTQTFMQTNERRQVGPPSFVPDSPSIPVGSP
NFSSVKQGHGNLSGTSFQQSPVRPSFTPALPAAPPVANSSLPCGQDSTMTHGHSYPGSTQ
SLIQLYSDIIPEEKGKKKRTRKKKRDDDAESTKAPSTPHSDITAPPTPGISETTSTPAVS
TPSELPQQADPESVEPVGPSTPNMAAGQLCTELENKLPNSDFSQATPNQQTYANSEVDKL
SMETPAKTEEIKLEKAETESCPGQEEPKLEEQNGSKVEGNAVACPVSSAQSPPHSAGAPA
AKGDSGNELLKHLLKNKKSSSFLNQKPEGSICSEDDCTKDNKLVEKQNPAEGLQTLGAQM
QGGFGCGNQLPKTDGGSETKKQRSKRTQRTGEKAAPRSKKRKKDEEEKQAMYSSTDTFTH
LKQQLSLLPLMEPIIGVNFAHFLPYGSGQFNSGNRLLGTFGSATLEGVSDYYSQLIYKQN
NLSNPPTPPASLPPTPPPMACQKMANGFATTEELAGKAGVLVSHEVTKTLGPKPFQLPFR
PQDDLLARALVQGPKTVDVPASLPTPPHNNQEELRIQDHCGDRDTPDSFVPSSSPESVVG
VEVSRYPDLSLVKEEPPEPVPSPIIPILPSTAGKSSESRRNDIKTEPGTLYFASPFGPSP
NGPRSGLISVAITLHPTAAENISSVVAAFSDLLHVRIPNSYEVSNAPDVPSMGLVSSHRI
NPGLEYRQHLLLRGPPPGSANPPRLVSSYRLKQPNVPFPPTSNGLSGYKDSSHGIAESAA
LRPQWCCHCKVVILGSGVRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNCFILYSSTAQV
KNSENKGSIPSLPQSPMRETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPA
FEAAQVEAKPDELKVTVKLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFK
PPCEDEIDEFLKKLGTSLKPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNC
ALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQ
CMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGS
LIFHTIGQLLPQQMQAFHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFV
IRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVA
RIAESLPGVEACESYTFRYGRNPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNST
STSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIE
KHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCA
PNCVAEVVTFERGHKIIISSNRRIQKGEELCYDYKFDFEDDQHKIPCHCGAVNCRKWMN

BLAST