GenomeNet

>ptr:469481 SETDB1; SET domain bifurcated 1; K11421 histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43] (A)
MCEVFGLWILEDKSMSSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDE
ELEKMDCVQQRKKQLAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQ
YRDSSSEDESSRPTEIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQK
FMDAVNKKSSSQDLHKGTLSHMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGP
GKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPN
VKNKLRFLIFFDDGYASYVTQSELYPICRPLTKTWEDIEDISCRDFIEEYVTAYPNRPMV
LLKSGQLIKTEWEGMWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSA
SALEKKQGQLRTRPNMGAVRSKGPVVQYTQDLTGTGTQFKPVEPPQPTAPPAPPFPPAPP
LSPQAGDSESLESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVSGGKPGINQT
YRSPLGSTASAPAPSALPAPPAPPVFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSR
VRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYL
FETGCDFLFLEMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQV
AYSKERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGY
QYKRLEECLPTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAK
GSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDL
KDQEDGNSGTEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETTSK
DSHPPDLGPPHIPVPPSIPVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSHSSFK
TNEGGEGRAGGSRMEAEKASTSGLGIKDEGDIKQAKKEDTDDRNKMSVVTESSRNYGYNP
SPVKPEGLRRPPSKTSMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTAGQTSA
TAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASV
DKGESAPVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFP
WVAFFASKRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL

BLAST