GenomeNet

>puv:PUV_10690 DNA ligase-like protein Rv0938/MT0965; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MSLGEYRSKRDLNKSKEPSAGKNKRSDALNFCIQKHAARRLHYDFRLEYKGVLLSWAVPK
GPSLDPYDKRLAIQVEDHPLDYQYFEGTIPKGNYGAGKVEIWDRGTYTVPHVTTREEIEK
YLTIGLKKGHFAVILHGEKLQGEFVFQKLKQDAEDTAWLLIKKEDAFATETDHDKPAKQV
KMPEFVTPMLATLADHPFSSEDWLFEIKWDGYRALAFIDPNNVQLKSRNRILLNDRFPVI
VDSLKKVKDKVIFDGELVVLDSAGKSDFQLMQNYQKDHAGVLYYYVFDLLYKDGQDLRNL
PLIERKNLLKKLLKELNLPLIRYSDHIVKDGEDFYKEAVKNKLEGIIGKKVTSTYQSRRS
QDWVKIKTALRQEVVIGGFTEPRGSRKKFGALLVGVYDDQGELHYVGHVGGGFTDELLED
VYKQLLPLSQKKSPFKNIPKPNMPVTWIKPKLVCEVSFAEWTKDDIMRQPIFRGLRIDKN
PKEVKKEIPTASEEKKGRTSKRQELELTNLDKLYWPKEKYTKGDLIAYYQKVAPYLLPYL
RNRPITLHRFPDGIEGKDFYQKNIDFSHPDWLKTFPVQHEGKVDHYLMISDLRSLLYAVN
LGSIDLHPFTSRCKNLEKPDYCIIDLDPHDIAFEKVIEIASATHELLERAKIKNYCKTSG
GKGLHIFIPLHAKYDYEQSKEFAHVIALCIHKQFPTITSVERSPQSRPKKIYLDYLQNRA
LQTIVAPYSVRPRPGALVSTPLLWEEVKPGLDPKDFDIHTILKRLDKMGDIFKPILGGGV
NMQTALNRLKKMFI

BLAST