GenomeNet

>puv:PUV_10690 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) putative DNA ligase-like protein Rv0938/MT0965 (A)
MSLGEYRSKRDLNKSKEPSAGKNKRSDALNFCIQKHAARRLHYDFRLEYKGVLLSWAVPK
GPSLDPYDKRLAIQVEDHPLDYQYFEGTIPKGNYGAGKVEIWDRGTYTVPHVTTREEIEK
YLTIGLKKGHFAVILHGEKLQGEFVFQKLKQDAEDTAWLLIKKEDAFATETDHDKPAKQV
KMPEFVTPMLATLADHPFSSEDWLFEIKWDGYRALAFIDPNNVQLKSRNRILLNDRFPVI
VDSLKKVKDKVIFDGELVVLDSAGKSDFQLMQNYQKDHAGVLYYYVFDLLYKDGQDLRNL
PLIERKNLLKKLLKELNLPLIRYSDHIVKDGEDFYKEAVKNKLEGIIGKKVTSTYQSRRS
QDWVKIKTALRQEVVIGGFTEPRGSRKKFGALLVGVYDDQGELHYVGHVGGGFTDELLED
VYKQLLPLSQKKSPFKNIPKPNMPVTWIKPKLVCEVSFAEWTKDDIMRQPIFRGLRIDKN
PKEVKKEIPTASEEKKGRTSKRQELELTNLDKLYWPKEKYTKGDLIAYYQKVAPYLLPYL
RNRPITLHRFPDGIEGKDFYQKNIDFSHPDWLKTFPVQHEGKVDHYLMISDLRSLLYAVN
LGSIDLHPFTSRCKNLEKPDYCIIDLDPHDIAFEKVIEIASATHELLERAKIKNYCKTSG
GKGLHIFIPLHAKYDYEQSKEFAHVIALCIHKQFPTITSVERSPQSRPKKIYLDYLQNRA
LQTIVAPYSVRPRPGALVSTPLLWEEVKPGLDPKDFDIHTILKRLDKMGDIFKPILGGGV
NMQTALNRLKKMFI

BLAST