GenomeNet

>pvx:PVX_111005 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) flavoprotein subunit of succinate dehydrogenase (A)
MLTVRRKCSPAFALSTRLNFSSVKKKAYDIVDHHYDAVIVGAGGAGLRSGLELSKNNYKV
ACISKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWLGDQNAIQYMCREAP
ESVLELEEFGLPFSRTKSGKIYQRAFGGQSLKYGKGGQAYRCAAAADRTGHAMLHTLYGQ
SLAYNCVFFVEYFVLDLLMASQNECIGVICLNIADGKIHRFFAPHTVIATGGYGRAYLSC
TSAHACTGDGNAIVSRSKLPLQDLEFVQFHPTGIYPAGCLITEGCRGEGGILRNREGEAF
MMRYAPKAKDLASRDVVSRAMTIEINEGRGCGPNADHIYLDLTHLPYETLKERLPGIMET
AKIFAGVNVTNQYIPVLPTVHYNMGGIPTNYKTQVLTQRVNSSKGVSTLEGEDIIVKGLY
AAGEAASASVHGANRLGANSLLDIVVFGKRASLTIMEIDKPNIPPISAQADIGDETIQRL
DKIRYNKGTISTAQIRKKMQVCMQKHAAVFRIGPLLEEGYKQILTICSQFNDVYVKDKTL
TWNTDLIETLELENLLTLASQTILAAIERKESRGAHARDDFPERDDKAFLKHSLTWMTDR
DVEKAKFFTTYRGVITKPLDDEMEHVPPVKRVY

BLAST