GenomeNet

>pvx:PVX_111005 flavoprotein subunit of succinate dehydrogenase; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MLTVRRKCSPAFALSTRLNFSSVKKKAYDIVDHHYDAVIVGAGGAGLRSGLELSKNNYKV
ACISKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWLGDQNAIQYMCREAP
ESVLELEEFGLPFSRTKSGKIYQRAFGGQSLKYGKGGQAYRCAAAADRTGHAMLHTLYGQ
SLAYNCVFFVEYFVLDLLMASQNECIGVICLNIADGKIHRFFAPHTVIATGGYGRAYLSC
TSAHACTGDGNAIVSRSKLPLQDLEFVQFHPTGIYPAGCLITEGCRGEGGILRNREGEAF
MMRYAPKAKDLASRDVVSRAMTIEINEGRGCGPNADHIYLDLTHLPYETLKERLPGIMET
AKIFAGVNVTNQYIPVLPTVHYNMGGIPTNYKTQVLTQRVNSSKGVSTLEGEDIIVKGLY
AAGEAASASVHGANRLGANSLLDIVVFGKRASLTIMEIDKPNIPPISAQADIGDETIQRL
DKIRYNKGTISTAQIRKKMQVCMQKHAAVFRIGPLLEEGYKQILTICSQFNDVYVKDKTL
TWNTDLIETLELENLLTLASQTILAAIERKESRGAHARDDFPERDDKAFLKHSLTWMTDR
DVEKAKFFTTYRGVITKPLDDEMEHVPPVKRVY

BLAST