GenomeNet

>pya:PYCH_15530 hypothetical protein; K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] (A)
MVSSHFKEILMRLGLPEDRIEVLEAKGGITEEEFDGIRYLRFKDSARGLRRGTVVFDEAN
VILGFPHIKRVVSLRAGVMRIFKRTPFYVEEKVDGYNVRVALVSDRVLAITRGGFVCPFT
TERILDFVPEEFFKDYPHLVLVGEMAGPESPYLVEGPPYVEEDIRFFLFDIQEKGTGKSL
PVQERLKLAEEYGIPHVKVFGLYTVDRIEDLYDLIERLSREGREGVVMKSPDMKRVVKYV
TPFANVNDVKIGAKVFFELPPGYFMSRIMRLAFYVAERRIKGERFEELARNLGKALLEPF
VESIWDVEQGDEIAEVFRIRVKRIETAYKMVTHFERLGLNIKIEDIEEVGGMWRITFKRA
YDEATREIRELIGGRAFVD

BLAST