GenomeNet

>pyn:PNA2_1142 K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] | (GenBank) hypothetical protein (A)
MVTSTFKDILVRLGIPESRVETLEMKGGIIEDEFEGIRYLRFKDSAGKFRRGTVVFNEKT
IVLGFPHIKRIVNLESGIRRTFKRGEFYVEEKVDGYNVRVVRVGDKILGITRGGFICPFT
TERITDFIPEEFFKDNPNLVLVGEMAGPESPYLVEGPPYVKEDIEFFLFDVQEINTGKSL
PVEERLKIAEEYGIRHVEVFGKFTRDDIGEIREIIERLSEEGREGIVMKSPDMKKIVKYV
TPFANINDIRIGAKVFYELPPGYFTSRISRLAFYIAENRIRGEEFNRIALELGKALLQPL
VESIFDVEQEEEISEVFKVRVKRIETAYKMVTHFEKLGLKIEIVDIEEIKGGWKITFKRI
YPDATEEIRELIGGKAFVD

BLAST