GenomeNet

>pyn:PNA2_1142 hypothetical protein; K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] (A)
MVTSTFKDILVRLGIPESRVETLEMKGGIIEDEFEGIRYLRFKDSAGKFRRGTVVFNEKT
IVLGFPHIKRIVNLESGIRRTFKRGEFYVEEKVDGYNVRVVRVGDKILGITRGGFICPFT
TERITDFIPEEFFKDNPNLVLVGEMAGPESPYLVEGPPYVKEDIEFFLFDVQEINTGKSL
PVEERLKIAEEYGIRHVEVFGKFTRDDIGEIREIIERLSEEGREGIVMKSPDMKKIVKYV
TPFANINDIRIGAKVFYELPPGYFTSRISRLAFYIAENRIRGEEFNRIALELGKALLQPL
VESIFDVEQEEEISEVFKVRVKRIETAYKMVTHFEKLGLKIEIVDIEEIKGGWKITFKRI
YPDATEEIRELIGGKAFVD

BLAST