GenomeNet

>pyn:PNA2_1387 K01622 fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11] | (GenBank) hypothetical protein (A)
MAVGEKITISVIKADVGGWPGHSRVHPALIEKAKEVLSEAQKEGTIIDFYVTYAGDDLQL
IMTHKKGVDSPEVHGLAWEAFKKATEVAKELALYGAGQDLLKDAFSGNVRGLGPSVAEME
ITLRKSEPIVTFHLDKTEPGAFNLPIFRMFADPFNTAGLVIDPKMHMGFRFEIWDILEHK
RVIMNSPEEMYDILALIGAKGRYVIKRVYPKEGHPIPKDEPVAVVSTEKLYEVAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPLMPVPLKYATPTRFDGPPRA
VALGWQISPEGKLIGPVDLFDDPAFDWARQKALEITDYMRRHGPFEPHRLPLEEMEYTTL
PGVLEKLKDRFEPIE

BLAST