GenomeNet

>pyo:PY01349 hypothetical protein; K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] (A)
MQPMCGYRNNHIPLLIYDRYYFWSLHFLFEKSKVKRQRLNINTKLGIQDCINKYNIYDEL
DMYTSIYNSAYNKYENTTDNQFNSYELNKRRNENANKHDSKNGNMFNNDQIKYLYLNGLK
NNKNILEDNSNDINDVKWYRLKIKIEEAGKKNKNTDKCNQKKSSNINSFSCLTNENENEN
LNKLIKMQKKKATFLNQNKVKMEDTENKSQIINNSSCNTQKNEKNGNQEKPIIISDTDNH
ISINNNAKRKKRKTWYYCHSSSNDMTDDDDEKPDSIVANHEIYIENTNEVNTGVKDGEHN
EYFETDKYCRENNFNCSHIGQSQNNIYDANNEIDKLKCRNDGKELDNKNDNDNSSTKLEG
MKNHCVNIEDTTIENDTETQKEKNKENLKTKNICIKENNTNKPINLNENTKLILESSKLY
KLENYEYVNCFKNMFYNNLEDQQNKINSHIFKKNKLDKDCIDIYINKILKNILDKKKPHL
NSLSKSFERIETLYKNNYKIFIIDDEDFYTCDKKEHFKNQNYLYELSDQTIENDVQNFED
NDIFNYFKKYIPTEPNVENFISESQDNYHAFQNERITTENVDIEGKSYSSFKEGIDVKEK
LKTEGNVLSKEGITETNHLTQNSIPTEFNKDCNDQKLEDISENTELVTDTDIIFAFISKK
HKSLEKKLKQGDYIYIKFNDTGHSYDKVKILPKKIIIQILIYLIKNTENIKLTTISTYSP
DLLWNISLHFRKYIIDLDICFEKLYKFFSEKREQENENGGKKEAKQGLADFYDSCISYYG
KSQNKKQDIEIMKLKDSVNFIDKFLQNINSRKIEKLKKSRIEYYGKYEYDRTINKLNKQQ
LIDLFIDKEAEINTIPLSYLKEKSRNIIYEENLKMNMFACIKVIFDSTKGRCIYADTQIN
KFDFVFEYVGELLTHNEAMEREQIYIKNKKKGCYMFYFKHENKRYCIDGTEESIDAAINY
TNKKYFLRSFARLVNHSKKNSNLIPKVLTVDFLPRLFFIASRDIQKGEELLIDYGERNRE
IIKDNEWLKL

BLAST