GenomeNet

>raa:Q7S_04675 xylose isomerase domain-containing protein TIM barrel; K01805 xylose isomerase [EC:5.3.1.5] (A)
MLQMIERAATVKGLTHLDLNYPQHMTGDITLMRQKIEEVGLAVNGMQMRWDAPEFKIGAF
THPDPKIRRQAIELTKRGIDAGREFGASIMTLWMGQDGFDYCFQADYKKIWEDAVSAVRE
VAEYAPDIDVSIEYKPNEPRAYSIFPNATTCLLAVEEAGCKNLGITLDFAHVLFANEVPA
FAAAMVARRSRLLGLDLNDGWGKRDDGLMVGSVNPRATLEFLLQMKRDGYKGAYYFDTFP
DASGLDPVREAETNIATVIRLLKLCEKLENNPALNEAISRQDAVATQQIVNDVMLAQ

BLAST