GenomeNet

>raa:Q7S_04675 K01805 xylose isomerase [EC:5.3.1.5] | (GenBank) xylose isomerase domain-containing protein TIM barrel (A)
MLQMIERAATVKGLTHLDLNYPQHMTGDITLMRQKIEEVGLAVNGMQMRWDAPEFKIGAF
THPDPKIRRQAIELTKRGIDAGREFGASIMTLWMGQDGFDYCFQADYKKIWEDAVSAVRE
VAEYAPDIDVSIEYKPNEPRAYSIFPNATTCLLAVEEAGCKNLGITLDFAHVLFANEVPA
FAAAMVARRSRLLGLDLNDGWGKRDDGLMVGSVNPRATLEFLLQMKRDGYKGAYYFDTFP
DASGLDPVREAETNIATVIRLLKLCEKLENNPALNEAISRQDAVATQQIVNDVMLAQ

BLAST