GenomeNet

>rae:G148_0445 Thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MFLENTINHAKQSGWMEVICGSMFSGKTEELIRRLRRAEMAGLNVEIFKPKLDTRYSEED
VVSHNRNKIRSTAVDTPNEILLLGSNCDVVGIDEAQFFDQGIVEVANQLANNGVRVVIAG
LDMDFKGRPFGPMPYLMATAEYVTKVHAICKRTGNLANYSMRTSTSQDLVELGETESYEA
VSRRVFVDEFLNKKS

BLAST