GenomeNet

>rae:G148_1297 hypothetical protein; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MEDRKTKLERFEESVLSKYQIYNSIFMTLPFSGVSNVGRFLPLFGEECKKGYQDNKTPTE
IVEEFFKKYAPQSSEKETNDLLFRFIQYIERQVVLFDAIEDAAFSTVNNMDGLGSIRNMK
EKAEARNKVTELKATLQKLKVRPVLTAHPTQFYPDSVLVIINDLTQAIKDNDLTTIKKLL
AQLGKTPFYKKEKPSPLDEAIGLIWYLENVFYHSMGNIYSYLKKHILKDEALKNPVVELG
FWPGGDRDGNPFVKPETTLKVAERLKKSILKNYYKDIRVLKRRLTFKGVEHLVKNLEDQL
YKAAFLEEENTLTLQEFRQSLEEIRAILISEHQSLFVDELDALLYKVDIFGFYFASLDIR
QDSRIHRIVIEDIAKSTSGKIIPENYSSLSCEEQIQVLSQVNGVLDLTSFNQEITKDTLG
SILMMMAIQKENGEKGCNRYIISNNQNAANVLEVYTLLKLCGWQNPTVDIVPLFETIDDL
DNAEEVMTTLYQNKDYKEHLKSRGYQQTIMLGFSDGTKDGGYLKANWSIYTAKERLTKIS
REYGIEVLFFDGRGGPPARGGGKSHQFYASFGKDIESDAIQITIQGQTISSNFGTLDSSQ
YNLEQLISAGVNNKIFTSEQASISSEEKEILQDLADISYQKYTEFKNHPKFIPYLEKMST
LKYYAKANIGSRPSKRGNSDTLNFSDLRAIPFVGSWSQLKQNVPGFYGVGTALAHYDANG
NFEKLKALYKKSLFFRTLLENSMMSLTKSFFKLTEYMKDDVEFGAFWQEIYQEYQLSKEM
LLKLTEFKSLMEDHPAGKASIQIREEMVLPLLTIQQYALKKVQDGSPLSEVYENMVVRSL
FGNINASRNSA

BLAST