GenomeNet

>rah:Rahaq_2643 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase (A)
MAQLYFYYSAMNAGKSTSLLQSSYNYQERGMRTLVLTAELDNRYGQGKVSSRIGLSSPAE
LYNTETELFNLVAQENRTQRLSCVLIDECQFLTKAQVSQLTDVVDDLDVPVLCYGLRTDF
RGELFEGSEYLLAWADKLVELKTICHCGRKANRNLRLDENGNALHDGAQVVIGGDESYVS
VCRKHYKEAMAAFDGRDESKTL

BLAST