GenomeNet

>rah:Rahaq_2765 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase domain protein (A)
MKLYYKPGACSLSPHIILREAGLDFSIEKVDLATKKTETGDDFLAVNPKGQIPTLLLNDG
SILTEGVAIVQYLADQKPDRQLMPEQGTLARYHALEWLNYIATELHKGFSPLFNPKAPEE
FKTLTREALSKKFAYVNTALKDNHFLLGTRFSVADAYLFTVMGWAKALKFDLSALTELNA
YLDRVAARPAVDAALSAEGLK

BLAST