GenomeNet

>rai:RA0C_1429 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (A)
MFLENTINHAKQSGWMEVICGSMFSGKTEELIRRLRRAEMAGLNVEIFKPKLDTRYSEED
VVSHNRNKIRSTAVDTPNEILLLGSNCDVVGIDEAQFFDQGIVEVANQLANNGVRVVIAG
LDMDFKGRPFGPMPYLMATAEYVTKVHAICKRTGNLANYSMRTSTSQDLVELGETESYEA
VSRRVFVDEFLNKKS

BLAST