GenomeNet

>rbi:RB2501_07505 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) superoxide dismutase, Mn family protein (A)
MEIHHTKHHNGYTTKLNNAIEGTDLDGKSIEDILKNLDMGNGAVRNNGGGYFNHSLFWEI
LSPDGGGKPSGDLASAIDDAFGSFDKFKEAFSNAAATRFGSGWAWLCVHPGGKVEVCSSP
NQDNPLMPGVGCGGYPILGIDVWEHAYYLNYQNRRPDYIEAFFNLINWSKVSENFAAHK

BLAST