GenomeNet

>rbi:RB2501_07505 superoxide dismutase, Mn family protein; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MEIHHTKHHNGYTTKLNNAIEGTDLDGKSIEDILKNLDMGNGAVRNNGGGYFNHSLFWEI
LSPDGGGKPSGDLASAIDDAFGSFDKFKEAFSNAAATRFGSGWAWLCVHPGGKVEVCSSP
NQDNPLMPGVGCGGYPILGIDVWEHAYYLNYQNRRPDYIEAFFNLINWSKVSENFAAHK

BLAST