GenomeNet

>rca:Rcas_1079 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase (A)
MTRLSSGGRIEVICGCMFSGKTEELIRRLNHVRLARQRLIAFTPRRDTRYRLGSLVSHNG
LSVEARVIDSIRDTPAHLNTDIHVVAVDELHLLDDPPDAAREVCQDLADRGLRVIVAGLD
QDFRAQPFPAMAQLMAVAEQVDKLYAICVRCGAYATRSQRLIDGKPAPADAPTIVVGGQE
LYEARCRACYEPAR

BLAST