GenomeNet

>rce:RC1_0240 ccbS2; ribulose bisphosphate carboxylase, small subunit (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MSVMQDYPSRLSDPGSRKLGTFSYLPPLDATQIRRQVEYIVAKGWNPALEHTEPEHAASH
YWYMWKLPLFGETDVDRVLAEIEACRQANPGHHIRLIGYDNIKQSQGTSMVVHRAPVAR

BLAST