GenomeNet

>rci:RCIX222 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) rbcL; ribulose 1,5-bisphosphate carboxylase (RuBisCO),large subunit (A)
MAIHGDKDLIIQVPLTLINIMTMVRTTYYVEADAPIAKVAKEIAAEQSTGTWTEVAAEKE
VHEKLGAHVVSAEGNTVVIDFPVEIFEPDNVPQILSVVAGNLFGLGGLKACRLMDVDFGP
LTKYYNGPEFGIEEVRKILGVYDRPLVGTIIKPKVGLSPKRTAEVAEQAALGGLDLIKDD
ETLTDQKFCPLEERLTMVMDRLHKVEDRIGKPCFYAVNVTCGADMIVERAERAVELGANM
VMVDILTAGFSAVQALTDEKIGVPIHIHRTMHGALTRGKYGIAMPVISKLTRMCGGTNLH
TGTYAGKMERNVCEIDASRDILRKPWAGYKRVWPVSSGGLYPQKVRENLDCYGIDVILQA
GGGIHGHPEGTTVGVKAMFQAVEAWQQQKTLEEYAKTHKELAGALKQWGPSQ

BLAST