GenomeNet

>rci:RCIX489 K00169 pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1] | (GenBank) porA-1; pyruvate:ferredoxin oxidoreductase, alpha subunit (A)
MAKMAVMEGSHAIAEAAKVCRPAVVSAYPITPQTHIVEDISQMIANGDLTNCEYVRTESE
FSAASVIQGAQAAGARTFSATASQGALLMYEVLFSIAGMRLPCVLAMANRAVSSPINIWN
DHQDAISARDSGWIQIWAEDNQEAADMIIQAYKIGEDPRVMLPVMVNMDGFLITHLYEPV
ETYDQKMVDEFLPPYNPQYKLDPKQPVTMGALAQPEYYTEARYMVHNAQIRAKEVIEEVA
AEFGKKFGRYKGGLIDTYKMEGAKIALVAMGSIIGTMKDAVDEMREAGVPVGIVKIRSYR
PFPVEALRAALKEAEIVCVLDRNISLGGEGAVFTDLKGALYNASHSPTMLGFIIGLGGRD
TTVEDIKNIVKKAQAKLGGERVSELEWYKLDVEILPEGI

BLAST