GenomeNet

>rci:RCIX489 porA-1; pyruvate:ferredoxin oxidoreductase, alpha subunit (EC:1.2.7.1); K00169 pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1] (A)
MAKMAVMEGSHAIAEAAKVCRPAVVSAYPITPQTHIVEDISQMIANGDLTNCEYVRTESE
FSAASVIQGAQAAGARTFSATASQGALLMYEVLFSIAGMRLPCVLAMANRAVSSPINIWN
DHQDAISARDSGWIQIWAEDNQEAADMIIQAYKIGEDPRVMLPVMVNMDGFLITHLYEPV
ETYDQKMVDEFLPPYNPQYKLDPKQPVTMGALAQPEYYTEARYMVHNAQIRAKEVIEEVA
AEFGKKFGRYKGGLIDTYKMEGAKIALVAMGSIIGTMKDAVDEMREAGVPVGIVKIRSYR
PFPVEALRAALKEAEIVCVLDRNISLGGEGAVFTDLKGALYNASHSPTMLGFIIGLGGRD
TTVEDIKNIVKKAQAKLGGERVSELEWYKLDVEILPEGI

BLAST