GenomeNet

>rci:RRC496 no KO assigned | (GenBank) conserved hypothetical protein (A)
MPSDRNLEPYREKRQFTRTPEPYGREEAPSDKPIFVVQKHDASHLHYDFRLEVGGVLKSW
AVPKGPSVDSKVKRLAMPTEDHPLDYAGFEGTIPEGNYGAGTVMVWDTGTYSNLRETKPA
GRGHAAMEQAVTEGKIEVRLDGKKLKGNYALIRTGLQGKGWLLFKMKDEFDRPGYDIVVE
EPDSALTGRTLNEIAGTKN

BLAST