GenomeNet

>rci:RRC496 hypothetical protein (A)
MPSDRNLEPYREKRQFTRTPEPYGREEAPSDKPIFVVQKHDASHLHYDFRLEVGGVLKSW
AVPKGPSVDSKVKRLAMPTEDHPLDYAGFEGTIPEGNYGAGTVMVWDTGTYSNLRETKPA
GRGHAAMEQAVTEGKIEVRLDGKKLKGNYALIRTGLQGKGWLLFKMKDEFDRPGYDIVVE
EPDSALTGRTLNEIAGTKN

BLAST