GenomeNet

>rci:RRC496 conserved hypothetical protein (A)
MPSDRNLEPYREKRQFTRTPEPYGREEAPSDKPIFVVQKHDASHLHYDFRLEVGGVLKSW
AVPKGPSVDSKVKRLAMPTEDHPLDYAGFEGTIPEGNYGAGTVMVWDTGTYSNLRETKPA
GRGHAAMEQAVTEGKIEVRLDGKKLKGNYALIRTGLQGKGWLLFKMKDEFDRPGYDIVVE
EPDSALTGRTLNEIAGTKN

BLAST