GenomeNet

>rcu:RCOM_0530950 succinate dehydrogenase, putative (EC:1.3.5.1); K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MATGLLRKGLSIARVSKTAPFTSRLIPTRFHASEAEAQKVEPKASSTASLKTFQIYRWNP
DNPSKPTLQDYKIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGCNG
LACLTKISSGSTSSTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPVDGKEIP
QSKKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTNERL
DAINDEFKLYRCHTILNCARACPKGLNPGKQIMHIKQLQMVGGA

BLAST