GenomeNet

>rcu:RCOM_1590660 pentatricopeptide repeat-containing protein, putative (EC:3.2.1.60); K01176 alpha-amylase [EC:3.2.1.1] (A)
MNRRKSIEILFWLFLLSIFPLSTSSALLFQGFNWESCNKGGGWYNLLKNSILDIANAGIT
HVWLPPPSQSVSPQGYMPGRLYDLNASRYGTQDELKSLIRAFHHKGIKCLADIVINHRTA
EKKDERGIWCIFEGGTDDDRLDWGPSFICCDDTVFSDGTGNPDTGEDYPPAPDIDHLNPR
VQKELSDWMNWLKLEIGFGGWRFDFAKGYSPTIMKIYMEQIPPGFAVGEKWDSLSYGQDW
KPDYNQDAHRNALKDWIQASGGVITAFDFTTKGILQAAVQGELWRLIDSNGNPPGLIGIM
PQNAVTFIDNHDTGSTQQLWPFPSDKVMQGYAYILTHPGIPTIFYDHFFDWGLKEQISKL
ASIRKNYGIDSRSGMKILAAESDLYMAAINDNVIMKIGPRMDLGNLLPSKEFQVATSGES
YAVWVKNGWMNFLEERSYSMKSQRPNLAPKGSNSLDANTEAIQIQNHLIKRGIDQFVYVS
TALLDLYMKLGRVSYAHNAFDYMPIRDVVSWNALICGYSRNGYDFSALELFVQMLKLGFC
PRQTTLVGLLPSCGQLELVFQGKSIHGFGIKSGLHLDPQVKNALTSMYAKCGDLEAAEYL
FEEMMDKSVVSWNTMIGAYGQNGFFDEAMFVFKRMIGAGVEVSQVTIMSLPSANANPESI
HCYTIKVGLADDASVVTSLICMYARYGSTDHAELLYWSLPQKNLVSLTAIITSYAEAGNL
GLVMESFSQMHQLNMKPDSVAMLSILHGIADPVHICIGHVFHGYAIKSGLDTFNLVTNGL
ISMYSKFNNVEALFGLFSGMHEKPLISWNSVISGCVQAGRASHAIELFCQMKMHGCNPDA
ITIASLLSGCSQLGYLQFGERLHSYILRNKLEMEDFVGTALIHMYTKCGSIVHAERVFKS
IGKPCLATWNAMISGYSCYGFEHKALTCYSEMQEQGVEPDKITFLGVLAACTHGGLIHEG
RRYFQIMTKVYDMVPTLQHCACMVGLLARVGLFEEALLFIKNMEKEPDSAVWGAFLSACC
IHQEVKLGEYLAKKLYLLDCRNGGLYVLMSNLYAVTGRWDDVARVREMMKDAGGDGNSGW
KLLMSNDEIRGHNNWVLINFSTKTEIRESKFTF

BLAST