GenomeNet

>rcu:RCOM_1655340 hypothetical protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MSPKTETKASVGFKASVKDYKLTYYTPKYETKDTDILAAFRVTPQPGVPPEEVGAAVAAE
SSTSTWTTVWTDGLTSLDHYKGRCYHIEPVAGEENQFIAYVVYPLDLFEEGSVTNMFTSI
VGNNYGRAVYKCLRGGLDFTKDDENVNSQPFMRWRDRFLFYAEAIYKAQAETGTCEEMIK
RVVFARESGVPIVMHDYLTGGFTANTTLVHYCRDNGLLLHIHRAMHAVIDRQKNHSMHFR
VLAKALRMSGGDHIHAGTVVGKLEGERDITLGFVDLLRDDFIEKDRSRGIYFTQDWVSLP
GVLPVASRGIHVWHMPALIEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARN
EGRDLAREGNEIIREVGKWSPELAATCEVWKEIKFEFPAMDTFWKNYINSCIGSYLRSQV
CIDSYILTGSYNYSESSIYSYICGESGNSNESQSSSLRTSTNGSDLTRRESSNDLDITIT
QKYKHLWVQCENCYGLNYKKFFKSRMNICEQCGYHLKMSSSDRIELSIDLGTWDPMDEDM
VSLDPIEFHSEEEPYKDRIDSYQRKTGLTEAIETGTVCLSGGVRMQEGSLSLMQMAKISS
ALYDYQSNKKLFYVSILTSPTTGEVTTSFGKRVIEQTLNKTVPEGSQSAEFLFYKGLFDS
IVPRNPLKGVLNELLQLHDFFPLNHKSSRV

BLAST