GenomeNet

>rec:RHECIAT_CH0000692 probable ATP-dependent DNA ligase protein (EC:6.5.1.1); K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MALETYQAKRNFKLTPEPRGQKGRSTGNSFVIQKHDATRLHYDFRLEMDGVLKSWAVTKG
PSLNPEDKRLAVHVEDHPLSYGDFEGIIPKGQYGGGTVIVWDRGTWTPVGDADKAYRKGH
LEFELDGEKLKGRWHLVRMHGRPGEARENWLLIKGDDAEARHDGNILEERPESAKTGRQL
EEVAENPDATWKSRSGNGKAVAAKTPAQKAKPSGSGERQWPKGARKGAMPDFIEPVLAKL
KPKPPAGDRWIHEIKFDGYRLQVRMEDGKVRMLTRSGLDWTAKFGKDVLDAFAALPVQSA
VIDGEIVVESDSGASDFSALQRDLSEGRNDRFVFYAFDLLHLDGHNLLDARLIDRKHLLE
SLLPADNDKLRYSAHFNERGGLVLDHACRLSLEGVLSKLRDSKYTSGRKGDWIKSKCSHR
QEFVIGGYVPSTSMKNAIGSLAMGYYRDGELKHVGRVGTGYTVATAQMLYEKLSRMTQNE
NSFDDKLTAEERRGLIYVKPQLVGEVEFRAWSADGNLRHAAFRGLREDKLAKEVTRETEQ
TAAPLPKAAVTLTHPDRIYWPDEGVTKEGLANYYAQVWRFMAPYVVNRPLALLRLPDGIN
GRQRFFQKHAWKGMNPHIEEIIDPKDKQGEKLLRITDFDGVVALVQSAVLEIHPWGTTTD
NWEKPDMITMDLDPGEAVAWEDVIVAAYELKARLEAEGLAAFVKTSGGKGLHVVTPLAPK
ASWVEVKAFAKGLADSMSADDPDRYLATATKAKRKGRIFIDYLRNGRGNTAVAAYSTRAR
PGAAVSMPLEWSELTADIGPAYFTVDNTPTRLDALPGDPWDGFFAAAKPLEKKKG

BLAST