GenomeNet

>rec:RHECIAT_CH0001250 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] | (GenBank) probable DNA ligase (ATP) protein (A)
MKAFADLLDRLVLTPSRNGKLKLLTDYFRDTPDPDRGYGLAAIAGTLEVRNVKPAMLREL
VLERMDEVLFRYSYDYVGDLAETISLVWDNERDIDRSALAQPRLGEVVSRMNGLGRTEVR
GYVRDLLDRLDSSGRFAFIKLATGAMRIGVSARLAKQALADLGGKDVTEIETLWHGLQPP
YEALFQWLTGGGDKPALATPAIFHSVMLANAVEEGDLTGLEPGDYAAEWKWDGIRVQLSR
SGDRRKIYSRSGDDISGAFPDILDAINFSGVVDGELLVGGTARSNSPTRTFSDLQQRLNR
KTVTARMLDDYPAFIRAYDLLFDDEEDVRGRTYVDRRERLSEIIDRAPHDRFDLSPLVPF
SSWEELDALRAAPPDPVIEGVMIKRRDSIYQAGRMKGPWFKWKRNPYNVDAVLMYAQRGH
GKRSSYYSDFTFGVWADDEDGEQLVPVGKAYFGFTDAELDLLDKFVRNNTTERFGPVRAV
RADRDFGFVVEVAFEGINRSTRHKSGVAMRFPRIARLRPDKPPYEADRLRTLIAMIDAKP
G

BLAST