GenomeNet

>rec:RHECIAT_CH0001295 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) sodB; superoxide dismutase protein (A)
MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKS
FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGA
TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA
FIDSLINWDYVLERYEEATK

BLAST