GenomeNet

>rec:RHECIAT_CH0001371 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gstch6; glutathione S-transferase protein (A)
MKLYYHPLSGHSHRVHLFLSLLGVPYELVEVDLAAGAHKAPEFLKLNAFGQVPVLDDDGT
VISDSSAILVYLARKFGRTDWLPEDILTAARIQKWLSVAAGEIAYGPCAARLVTVFGANF
HADEVIARAHRILALVEAELSGRAFLLGDNPTIADIALYSYIANAPEGNVDTSPYQAVRA
WLGRIEALPGFVGFSKTKIGLAA

BLAST