GenomeNet

>rec:RHECIAT_CH0002309 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) putative phosphoenolpyruvate carboxylase protein (A)
MDFQLRKAGMQGRRLAARAQVKDVRLLGRLLCEAIEASDGKEAREIVEQVRSLSVTGGRK
TSPRLNDKLAPFCADIPPRTLKRVVRAFSQFSQLVNIAEDAHHARAQRLSIVEGEPAMPG
TIARSLSVLAAAGIEAENIRKLLLEAVVSPVFTAHPTEVRRKSVIDIEQELARCLSRLDQ
AGLTAQEVDRYQDDLERATTTLWQTNSLRGRKLQVVDEILNGLSYYDSTIFHAIPEVYED
LENQLRGSPWKFGQDALPPFLRMGSWIGGDRDGNPYVNGETLKEALRLQSERVFSFYLGE
LHSLGAELSLDDRYVKVSRDLQRLATDSPDRSEQRRHEPYRLAISGIYARLAATARKFGS
TELVREPVAAAPSYRNPAEFAEDLATISKSLIANGAEKIAAGKLRGLRRAIEVFGFHLVS
LDLRQNSEVHQRVVHELFEKVRPGTGYEALAESDKIRLLTEELRSSQLLVTPLKTYSAET
MSELSVLREAAEAHKRYGRASIPNYIISKAGSPSDILEVMVLFREVELFRPDEPEAASVN
IIPLFETISDLRRSHEVMQTVLAIEAYRAYLGALGGKQEIMLGYSDSNKDGGYLTSGWEL
YKAEMAFIQLFEREGIRLSLFHGRGGSVGRGGGPSYEAITAQPAGAVADSIRLTEQGEVI
AAKYSNPALGRRNLELLIAATLEASLLPSDAQEPDPDYLGAMEELSDLAFGVYRSLVYET
EGFEKFFWETTIIGEIAKLNIGSRPASRSSSRRIEDLRAIPWVFGWSQSRIMLPGWFGFG
SAVRQWLAGQPDGLRTLQRMHRDWPFFQTLIANMEMVLAKTNMAIAARYVDLAPDTSTHE
KIFARIKDEWEATTAALFGITDQASLLENNPALKQSIHHRFPCLDPLNHMQIDLLRRHYA
GERDQETEEALHLTINGIAAGLRNSG

BLAST