GenomeNet

>rec:RHECIAT_CH0002414 K00031 isocitrate dehydrogenase [EC:1.1.1.42] | (GenBank) icd; isocitrate dehydrogenase (NADP(+)) protein (A)
MNKIKVANPVADLDGDEMTRIIWQLIKDKLIHPYLDLDIDYYDLSVENRDATNDQVTVDA
ANAIKKYGVGIKCATITPDEARVKEFNLKEMWKSPNGTIRNILGGVIFREPIICRNVPRL
VPGWTQPIVVGRHAFGDQYRATDFKFPGKGKLTIKFVGEDGTVIEKEVFNAPGAGVAMAM
YNLDESIREFARASMMYGLMRKWPVYLSTKNTILKAYDGRFKDIFEEVYETEFKDQFKEA
GITYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDGKT
VEAEAAHGTVTRHYRQHQKGQETSTNSIASIFAWTRGLAHRAKLDDNAALAKFASTLEKV
CVDTVESGFMTKDLALLIGPDQPWLSTTAFLDKIDQNLQKAMA

BLAST