GenomeNet

>rec:RHECIAT_CH0002523 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gstch9; glutathione S-transferase protein (A)
MSLVFYGHPLASFCHKVLIALYENGTPFENRIVDLSDETSRSDLFRFWPIGKMPLLRDEA
RDSTIPETSIIIEYLDHYYPGPAALLPLEIDRALQVRLWDRFFDHYVQAPMQTLVSNRRR
PEGKADEIEMAASRATLATAYTMIEKQLGDSPWITGGAFTMADCAAAPSLFYAETLVPFS
PEQPRLRAYYERLLTRPSFARALEEARPYFKFYPYHDRLPARFRDAAE

BLAST