GenomeNet

>rec:RHECIAT_CH0004170 K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] | (GenBank) sucA; oxoglutarate dehydrogenase E1 protein (A)
MARQEANEQFQITSFLDGANAAYIEQLYARYEEDPASVDDQWRAFFKALEEDPADVKKAA
KGASWRKKNWPLPASGDLVSALDGNWGIVEKAIETKVKAKAEAAGKPADSTDVLQATRDS
VRAIMMIRAYRMRGHLHAKLDPLGIAAAVDDYHELSPENYGFTAADYDRKIFIDNVLGLE
HATIREMIEILERTYCSTLGVEFMHISNPEEKAWIQERIEGPDKGVAFSAEGKKAILAKL
VEAEGYEQFLDVKFKGTKRFGLDGGESLIPALEQILKRGGHLGLKEAVFGMAHRGRLNVL
SQVMGKPHRAIFHEFKGGSYAPDEVEGSGDVKYHLGASSDREFDGNKVHVSLTANPSHLE
IVDPVVMGKARAKQDMSATVWEGDIIPLSERSKVLPLLIHGDAAFAGQGVIAEILGLSGL
RGHRVAGTMHVIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPILHVNGDDPEAVVYAAKV
ATEFRMKFHKPVVLDMFCYRRYGHNEGDEPSFTQPKMYKVIRGHKTVLQLYAERLVREGL
VTDGEVEKMKADWRAHLEQEFDAGQHYKPNKADWLDGEWSGLRTADNQDEQRRGKTAVPM
KTLKEIGRKLSEIPAGFNAHRTIQRFMENRSNMIQSGEGLDWAMAEALAFGSLVVEGHKI
RLSGQDCERGTFSQRHSVLYDQETEERYIPLANLAPTQARYEVINSMLSEEAVLGFEYGY
SLARPNALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHSS
ARLERFLQLCAEDNMQVANVTTPANYFHILRRQLKRDFRKPLILMTPKSLLRHKRAVSTL
AELAGESAFHRLLWDDAEVIKDGPIKLQKDSKIRRVVMCSGKVYYDLLEEREKRGIDDIY
LLRVEQLYPFPAKALINELSRFRNAEMVWCQEEPKNMGAWSFIDPFLEWVLAHIDAKYQR
VRYTGRPAAASPATGLMSKHLSQLAAFLEDALGG

BLAST