GenomeNet

>rec:RHECIAT_PA0000164 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gsta; glutathione S-transferase protein (A)
MAYELYYWDGIQGRGEFVRLALEEAGADYVDITREPGRGTGAMFDIMESESEAHIPFAPP
FLKDGELIIPHVANILFYLGPRLGLAPQDEGLRHVANGLQLTVTDFVAEVHDTHHPIDMG
RYYEDQKQEAKARSATFIGQRIPKYLGYFERVLRQNPDGSGHIVGDTLTYVDLSLFQVIE
GLTYAFPKAMAKRKAEYPALLALHAAVGKRANIARYLASPRRLPFNEEGIFRHYPELDSA
E

BLAST