GenomeNet

>rec:RHECIAT_PA0000196 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) putative ATP-dependent DNA ligase protein (A)
MTRPRQPSAPLLRESSSSIQSRPVRRRDPAQPSLPFDAMPTRVEPCLALLKQTVPQGPDW
IYEVKWDGYRLAIHIEPKGIRILTRGGHDWTHRFPTIAAGASALGVSSCILDGEAVVLDE
EGRSDFGALQRSLGGRGGKRVSTESIFCAFDLLYLDGHDLTRTELSVRRHLLQDLIPGTD
EGAIRFSQELDLSGEDLLEHACHLGLEGIIAKRGDRPYRSGRLGDWQKIKCVQSDSFMIV
GYEESASTRGGLGSLLLAGRKGQDWIYVGSVGTGFNREEAEYLRKTLNRLQTKKPVVPLK
GKRLVFSQPTLIAEIEFRGWTREGSLRHASYKGLREIQDNAAVFDMTDGPAAIR

BLAST