GenomeNet

>rec:RHECIAT_PC0000964 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) rbcL; ribulose bisphosphate carboxylaseoxygenase protein, large subunit (A)
MITLTYRIETPGSVEAMADKIASDQSTGTFVPVPGETEELKSRVAARVLAIRPLEDARHP
TWPEASPGTLLHRADVDIAFPLEAIGTDLSALMTIAIGGVYSIKGMTGIRIVDMKLPEVF
RSAHPGPQFGIAGSRRLTGVEGRPIIGTIVKPALGLRPHETAELVGELIESGVDFIKDDE
KLMSPAYSPLKERVAAIMPRILDHEQKTGRKVMYAFGISHADPDEMMRNHDIVAAAGGNC
AVVNINSIGFGGMSFLRKRSSLVLHAHRNGWDVLTRNPGAGMDFKVYQQFWRLLGVDQFQ
INGIRVKYWEPDDSFVSSFEAVSTPLFDAADCPLPVAGSGQWGGQAPETYERTGRTVDLL
YLCGGGIVSHPGGPAAGVRAVQQAWQAAVAGIPLEVYAKDHPELAASIAKFSDGKGA

BLAST