GenomeNet

>rer:RER_45220 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ligD; ATP-dependent DNA ligase LigD (EC:6.5.1.1) (A)
MATTDRGQITLDGTTVSVTNLGKIFYPESGTTKAEVIDYYTRIAAVMLPHVVGRPGTRKR
WPNGVDGQSFFEKNLASSAPQWLTRASLQHSDRVVTYPIFDSVASLAWLGQQAALELHVP
QWRFDGSERGPATRLVFDLDPGEGVGLAECAEVARSIRDLVATLGWTAYPVTSGSKGIHL
YVPLDRALDGSGASTVAKQIATGLEKLHPDLVTATMARNVRAGKIFVDWSQNNAAKTTIA
PYSMRGRDQPYVAAPRSWDELDDPKLRHLLFDEVLERVESDGDLLGDLDPPVSAAVADTL
AHYRNKRSADRTPEPIPAAVANETAGNTFVIQEHHARRLHYDVRLERDGVLVSWAVPKGV
PTSAGENRLAVHTEDHPLEYATFAGTIPKGEYGGGSMTIWDSGTYETEKWREDEVIVRLS
GERVQGRFALIRTKGDQWLMHLMKDQNASFGTEFPKNLEPMLATAGTLEGLDPQEWAFEG
KWDGIRVILEYRSGTMSLRSRAGNDKTRDYPALAGLAAVLDGHDVVLDGEVVAYNDAGVT
DFGLLQRGGEPVFLAFDLLYLDGVSLLRKSYSDRRTVLNALAGKVGELEVPPQIEGTAEN
ALEVSTDAGWEGIVAKRRASVYLPGRRGSSWIKVKNWRTQEVVIGGWRTGQGNRAQGIGA
LLMGIPGEDGLTYVGRVGTGFSDRDLESLLAVLEPLRQKESPFEEELPADDRKGAVWVRP
ELVGEARFMDWTATGRLRHPSWRGLREDKKPGDVTGRE

BLAST