GenomeNet

>ret:RHE_CH01074 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gstch5; glutathione S-transferase protein (A)
MKLYYCETLNPRKACAAARFLQADVEFVRVDLASGEQRSAEFLALNPNGKVPVLQEDAGT
LWEANAIMCRLSDTVASDFWPHDHRQIDVLRWLSWDASHFTRHGATLWFETMIKPLFGGE
PDAAVIEDAKTSFRLHGRVLDDHLAINRVAVGKTLTVADFALAAALPYATAADIPLAEFR
HIQKWYARLEELDAWQNPFPA

BLAST