GenomeNet

>ret:RHE_CH01147 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gstch6; glutathione S-transferase protein (A)
MLTLYYASGTCALASLIALEESGLAFETKKLSFANSEQRSPDYLKINPKGRVPALVTDRG
VLTETPAILGFIADSAPTAKLAPLGDAFEMARLQSFNSYLCSTVHVNHAHRRRGSRWTDD
PAAIEAMKAKVPQNMADCFTLIEETMFDAPWVMGETYSLADPYLFVMTDWLPADGVDPAR
FAKVSDHHARMLQRPAVQRALAFDRG

BLAST